PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G196900.1
Common NamePHAVU_001G196900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 382aa    MW: 42024.1 Da    PI: 4.3866
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G196900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF32.79.9e-111155246
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                         ien   r+  + + r+ +lKK e L +LCd++++vii+++ +++
  Phvul.001G196900.1 11 LIENFVARKARYKRNRENLLKKVEDLTTLCDVNACVIIYGPGDNV 55
                        6999999*********************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.5E-11261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.344250IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-5424IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-17491IPR002100Transcription factor, MADS-box
CDDcd002661.37E-18485No hitNo description
PfamPF003193.7E-101255IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-52439IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-53960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MPRRRKVTLK LIENFVARKA RYKRNRENLL KKVEDLTTLC DVNACVIIYG PGDNVPTVWP  60
SHEIANELLT KFENAPLPDR VRKNVTPQVY IEQMNKKIEN QLVKLKKKND EKDMSNFMHK  120
IHDGKSLSDL DATDICRLLC YVEGKLKCAG GKVDISKQQS STKPPTPLLS FPLQNDIVSC  180
ADIDEQVFPQ QPSLDSMKET DPMKSDSDNN MASNTGLPPL QPQTHLSDDI MALSQVNFES  240
LNLDDIDMVL PSGNFNDVID DNDLGFGMLP QDNFIGLCDN GDLGPFYGSS SGEITGNDIW  300
SSYGSFGDIS ESDMMLPFNN NVQDNINGTF MGTDVENQGV SINNIELSGD QSTFGANNDG  360
AILGKSSTNF VSTTSGGNFN S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115PRRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007162987.10.0hypothetical protein PHAVU_001G196900g
TrEMBLV7D1B20.0V7D1B2_PHAVU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15602811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.12e-25AGAMOUS-like 38